H00055802-D01

DCP1A antibody from Abnova Corporation
HSA275986, SMAD4IP1, SMIF

Antibody data

Product number
H00055802-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055802-D01, RRID:AB_10551973
Product name
DCP1A MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00055802-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human DCP1A protein.
Antigen sequence
MEALSRAGQEMSLAALKQHDPYITSIADLTGQVAL
YTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV
NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIY
SIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK
QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGD
SNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA
PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERL
PGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA
HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLS
PVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR
QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTA
GTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNM
VLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLV
TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPS
PLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS
FLSTLHEVYLQVLTKNKDNHNL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -