HPA000451

MKI67 antibody from Sigma-Aldrich
MIB-, PPP1R105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000451
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000451, RRID:AB_1079186
Product name
Anti-MKI67 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000451
Antibody type
Polyclonal
Antigen
Antigen KI-67 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTE
TEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTA
GQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRV
SFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVM
HTPPVLKKIIK
Storage
-20C
Provider Type Product Number
- No reagents -