Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011236-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011236-A01, RRID:AB_463105
- Product name
- RNF139 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant RNF139.
- Antigen sequence
HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNS
NVSNNNGFIPPNETPEEAVREAAAESDRELNEDDS
TDCDDDVQRERNGVIQHTGAAAEEFNDDTD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage.
RING-dependent tumor suppression and G2/M arrest induced by the TRC8 hereditary kidney cancer gene.
Lee JP, Brauweiler A, Rudolph M, Hooper JE, Drabkin HA, Gemmill RM
Molecular cancer research : MCR 2010 Jan;8(1):93-106
Molecular cancer research : MCR 2010 Jan;8(1):93-106
The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
Stagg HR, Thomas M, van den Boomen D, Wiertz EJ, Drabkin HA, Gemmill RM, Lehner PJ
The Journal of cell biology 2009 Sep 7;186(5):685-92
The Journal of cell biology 2009 Sep 7;186(5):685-92
The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage.
Irisawa M, Inoue J, Ozawa N, Mori K, Sato R
The Journal of biological chemistry 2009 Oct 16;284(42):28995-9004
The Journal of biological chemistry 2009 Oct 16;284(42):28995-9004
RING-dependent tumor suppression and G2/M arrest induced by the TRC8 hereditary kidney cancer gene.
Brauweiler A, Lorick KL, Lee JP, Tsai YC, Chan D, Weissman AM, Drabkin HA, Gemmill RM
Oncogene 2007 Apr 5;26(16):2263-71
Oncogene 2007 Apr 5;26(16):2263-71
No comments: Submit comment
No validations: Submit validation data