Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502917 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Decorin (DCN) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DCN antibody: synthetic peptide directed towards the C terminal of human DCN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRC
VYVRS AIQLGNYK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Effects of decorin on the expression of alpha-smooth muscle actin in a human myofibroblast cell line.
Nakatani T, Honda E, Hayakawa S, Sato M, Satoh K, Kudo M, Munakata H
Molecular and cellular biochemistry 2008 Jan;308(1-2):201-7
Molecular and cellular biochemistry 2008 Jan;308(1-2):201-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting