Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311062 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PCMT1 antibody: synthetic peptide directed towards the middle region of human PCMT1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGP
AGGNQ MLEQYDKLQD- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Suppression of protein l-isoaspartyl (d-aspartyl) methyltransferase results in hyperactivation of EGF-stimulated MEK-ERK signaling in cultured mammalian cells.
Kosugi S, Furuchi T, Katane M, Sekine M, Shirasawa T, Homma H
Biochemical and biophysical research communications 2008 Jun 20;371(1):22-7
Biochemical and biophysical research communications 2008 Jun 20;371(1):22-7
No comments: Submit comment
No validations: Submit validation data