HPA007534

PDPN antibody from Sigma-Aldrich
aggrus, Gp38, GP40, PA2.26, T1A-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007534, RRID:AB_1857718
Product name
Anti-PDPN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007534
Antibody type
Polyclonal
Antigen
Podoplanin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLPRVWEARAPSLSGAPAPTPPAPPPSRSSRLGLW
PRCFLIFPQLRILLLGPQESNNSTGTMWKVSALLF
VLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMP
GAEDDVVTPGTSEDRYKSGLTTLVATSVNS
Storage
-20C
Provider Type Product Number
- No reagents -