Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000875-A02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000875-A02, RRID:AB_606027
- Product name
- CBS polyclonal antibody (A02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CBS.
- Antigen sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPED
KEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP
AKSPKILPDILKKIGDTPMVRINKIGKKFG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Integrated stress response modulates cellular redox state via induction of cystathionine γ-lyase: cross-talk between integrated stress response and thiol metabolism.
Hyperhomocysteinemia associated with decreased renal transsulfuration activity in Dahl S rats.
Dickhout JG, Carlisle RE, Jerome DE, Mohammed-Ali Z, Jiang H, Yang G, Mani S, Garg SK, Banerjee R, Kaufman RJ, Maclean KN, Wang R, Austin RC
The Journal of biological chemistry 2012 Mar 2;287(10):7603-14
The Journal of biological chemistry 2012 Mar 2;287(10):7603-14
Hyperhomocysteinemia associated with decreased renal transsulfuration activity in Dahl S rats.
Li N, Chen L, Muh RW, Li PL
Hypertension 2006 Jun;47(6):1094-100
Hypertension 2006 Jun;47(6):1094-100
No comments: Submit comment
No validations: Submit validation data