HPA005933

OCLN antibody from Sigma-Aldrich
PPP1R115
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005933, RRID:AB_1079520
Product name
Anti-OCLN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005933
Antibody type
Polyclonal
Antigen
Occludin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYV
ERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVV
QELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGR
AGRSKRTEQDHYETDYTTGGESCDELEED
Storage
-20C
Provider Type Product Number
- No reagents -