Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30220 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SOD2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human SOD2.
- Antigen sequence
VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEP
HINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAK
GDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGG
GEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGS
GWGWL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4 cell line, Lane 2: U-251MG sp cell line, Lane 3: A-431 cell line, Lane 4: human liver tissue, and Lane 5: human tonsil tissue with SOD2 polyclonal antibody (Cat # PAB30220).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH/3T3 cell lysate and Lane 2: NBT-II cell lysate with SOD2 polyclonal antibody (Cat # PAB30220).