HPA001401

SOD1 antibody from Sigma-Aldrich
ALS, ALS1, IPOA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001401
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001401, RRID:AB_1080132
Product name
Anti-SOD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001401
Antibody type
Polyclonal
Antigen
Superoxide dismutase [Cu-Zn] recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHV
HEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVG
DLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTL
VVHEKADDLGKGGNEESTKTGNAGSRLACG
Storage
-20C
Provider Type Product Number
- No reagents -