Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310165 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glutathione Peroxidase 3 (Plasma) (GPX3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVL
FVNVA SYUGLTGQYI- Vial size
- 50 µg
Submitted references Psychiatric patient stratification using biosignatures based on cerebrospinal fluid protein expression clusters.
Hypermethylation and loss of expression of glutathione peroxidase-3 in Barrett's tumorigenesis.
Maccarrone G, Ditzen C, Yassouridis A, Rewerts C, Uhr M, Uhlen M, Holsboer F, Turck CW
Journal of psychiatric research 2013 Nov;47(11):1572-80
Journal of psychiatric research 2013 Nov;47(11):1572-80
Hypermethylation and loss of expression of glutathione peroxidase-3 in Barrett's tumorigenesis.
Lee OJ, Schneider-Stock R, McChesney PA, Kuester D, Roessner A, Vieth M, Moskaluk CA, El-Rifai W
Neoplasia (New York, N.Y.) 2005 Sep;7(9):854-61
Neoplasia (New York, N.Y.) 2005 Sep;7(9):854-61
No comments: Submit comment
No validations: Submit validation data