HPA018433

CBR1 antibody from Sigma-Aldrich
CBR, SDR21C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018433, RRID:AB_1846109
Product name
Anti-CBR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018433
Antibody type
Polyclonal
Antigen
Carbonyl reductase [NADPH] 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRV
VNVSSIMSVRALKSCSPELQQKFRSETITEEELVG
LMNKFVE
Storage
-20C
Provider Type Product Number
- No reagents -