HPA001527

TF antibody from Sigma-Aldrich
PRO1557, PRO2086
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001527, RRID:AB_1080357
Product name
Anti-TF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001527
Antibody type
Polyclonal
Antigen
Serotransferrin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLV
YDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVK
KDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYC
DLPEPRKPLEKA
Storage
-20C
Provider Type Product Number
- No reagents -