HPA021827

FHOD3 antibody from Sigma-Aldrich
FHOS2, FLJ22297, FLJ22717, KIAA1695
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021827, RRID:AB_1848571
Product name
Anti-FHOD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021827
Antibody type
Polyclonal
Antigen
FH1/FH2 domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLE
ELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHE
DGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRR
RSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Storage
-20C
Provider Type Product Number
- No reagents -