Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310996 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP5B antibody: synthetic peptide directed towards the C terminal of human ATP5B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGP
IEEAV AKADKLAEEH- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Diggin' on u(biquitin): a novel method for the identification of physiological E3 ubiquitin ligase substrates.
Ecto-F1-ATPase and MHC-class I close association on cell membranes.
Rubel CE, Schisler JC, Hamlett ED, DeKroon RM, Gautel M, Alzate O, Patterson C
Cell biochemistry and biophysics 2013 Sep;67(1):127-38
Cell biochemistry and biophysics 2013 Sep;67(1):127-38
Ecto-F1-ATPase and MHC-class I close association on cell membranes.
Vantourout P, Martinez LO, Fabre A, Collet X, Champagne E
Molecular immunology 2008 Jan;45(2):485-92
Molecular immunology 2008 Jan;45(2):485-92
No comments: Submit comment
No validations: Submit validation data