Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310995 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP5B antibody: synthetic peptide directed towards the N terminal of human ATP5B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAP
IHAEA PEFMEMSVEQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria.
Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain.
Liver mitochondrial membrane crosslinking and destruction in a rat model of Wilson disease.
Ecto-F1-ATPase and MHC-class I close association on cell membranes.
Guo J, Prokai-Tatrai K, Nguyen V, Rauniyar N, Ughy B, Prokai L
Journal of proteomics 2011 Oct 19;74(11):2370-9
Journal of proteomics 2011 Oct 19;74(11):2370-9
Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain.
Li N, Bates DJ, An J, Terry DA, Wang E
Neurobiology of aging 2011 May;32(5):944-55
Neurobiology of aging 2011 May;32(5):944-55
Liver mitochondrial membrane crosslinking and destruction in a rat model of Wilson disease.
Zischka H, Lichtmannegger J, Schmitt S, Jägemann N, Schulz S, Wartini D, Jennen L, Rust C, Larochette N, Galluzzi L, Chajes V, Bandow N, Gilles VS, DiSpirito AA, Esposito I, Goettlicher M, Summer KH, Kroemer G
The Journal of clinical investigation 2011 Apr;121(4):1508-18
The Journal of clinical investigation 2011 Apr;121(4):1508-18
Ecto-F1-ATPase and MHC-class I close association on cell membranes.
Vantourout P, Martinez LO, Fabre A, Collet X, Champagne E
Molecular immunology 2008 Jan;45(2):485-92
Molecular immunology 2008 Jan;45(2):485-92
No comments: Submit comment
No validations: Submit validation data