HPA001528

ATP5B antibody from Sigma-Aldrich
ATPSB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001528
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001528, RRID:AB_1078242
Product name
Anti-ATP5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001528
Antibody type
Polyclonal
Antigen
ATP synthase subunit beta, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEV
SALLGRIPSAVGYQPTLATDMGTMQERITTTKKGS
ITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRA
IAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVAR
Storage
-20C
Provider Type Product Number
- No reagents -