HPA002131

VCL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002131, RRID:AB_1080570
Product name
Anti-VCL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002131
Antibody type
Polyclonal
Antigen
Vinculin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLIS
AMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEIN
EIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKL
NQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGEL
CAGKERREI
Storage
-20C
Provider Type Product Number
- No reagents -