HPA024779

MICU3 antibody from Sigma-Aldrich
DKFZp313A0139, EFHA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024779
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024779, RRID:AB_1848023
Product name
Anti-EFHA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024779
Antibody type
Polyclonal
Antigen
EF-hand domain-containing family member A2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPVAAAKETVAIGRTDIEDLDLYATSRERRFRLFA
SIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSK
QELNQMLAETPPVWKGSSKLFRNLK
Storage
-20C
Provider Type Product Number
- No reagents -