Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007023-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007023-M02, RRID:AB_875887
- Product name
- TFAP4 monoclonal antibody (M02), clone 7C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TFAP4.
- Antigen sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKR
RRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQL
DKERSVRMMLEEQVRSLEAHMYPEKLKVIA- Isotype
- IgG
- Antibody clone number
- 7C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAP4 monoclonal antibody (M02), clone 7C5 Western Blot analysis of TFAP4 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAP4 monoclonal antibody (M02), clone 7C5. Western Blot analysis of TFAP4 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol