H00007528-B01

YY1 antibody from Abnova Corporation
DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1

Antibody data

Product number
H00007528-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007528-B01, RRID:AB_939526
Product name
YY1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00007528-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human YY1 protein.
Antigen sequence
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVET
IETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGH
HHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVIL
VQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAG
GDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKG
GGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQV
QIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGE
NSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFA
RMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRK
HLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVC
PFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -