HPA002990

NFE2L2 antibody from Sigma-Aldrich
NRF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002990, RRID:AB_1079476
Product name
Anti-NFE2L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002990
Antibody type
Polyclonal
Antigen
Nuclear factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQNHPESTAEFNDSDSGISLNTSPSVASPEHSVES
SSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVH
SSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVS
PGHRKTPFTKDKHSSRLEAHLTRDELR
Storage
-20C
Provider Type Product Number
- No reagents -