Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003142-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003142-M05, RRID:AB_1137256
- Product name
- HLX1 monoclonal antibody (M05), clone 1B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HLX1.
- Antigen sequence
FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAG
VHLSGLQPSAGQFFASLDPINEASAILSPLNSNPR
NSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS- Isotype
- IgG
- Antibody clone number
- 1B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HLX expression in transfected 293T cell line by HLX1 monoclonal antibody (M05), clone 1B9.Lane 1: HLX transfected lysate (Predicted MW: 50.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of HLX transfected lysate using anti-HLX monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HLX MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol