Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004092-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004092-M06, RRID:AB_581778
- Product name
- SMAD7 monoclonal antibody (M06), clone 4E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMAD7.
- Antigen sequence
CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCN
PHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAV
PSSAETGGTNYLAPGGLSDSQLLLEPGDRSH- Isotype
- IgG
- Antibody clone number
- 4E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMAD7 monoclonal antibody (M06), clone 4E1. Western Blot analysis of SMAD7 expression in human placenta.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMAD7 monoclonal antibody (M06), clone 4E1 Western Blot analysis of SMAD7 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SMAD7 monoclonal antibody (M06), clone 4E1. Western Blot analysis of SMAD7 expression in U-2 OS ( Cat # L022V1 ).