Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487083 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the middle region of human NR1H2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFS
RAMRR LGLDDAEYAL- Vial size
- 50 µg
Submitted references ABCA12 regulates ABCA1-dependent cholesterol efflux from macrophages and the development of atherosclerosis.
Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
Fu Y, Mukhamedova N, Ip S, D'Souza W, Henley KJ, DiTommaso T, Kesani R, Ditiatkovski M, Jones L, Lane RM, Jennings G, Smyth IM, Kile BT, Sviridov D
Cell metabolism 2013 Aug 6;18(2):225-38
Cell metabolism 2013 Aug 6;18(2):225-38
Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
Schmuth M, Jiang YJ, Dubrac S, Elias PM, Feingold KR
Journal of lipid research 2008 Mar;49(3):499-509
Journal of lipid research 2008 Mar;49(3):499-509
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting