Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183608 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Friend Leukemia Virus Integration 1 (FLI1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMT
ASGSP DYGQPHKINP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Ciprofloxacin has antifibrotic effects in scleroderma fibroblasts via downregulation of Dnmt1 and upregulation of Fli1.
FLI-1 functionally interacts with PIASxalpha, a member of the PIAS E3 SUMO ligase family.
The Btk inhibitor LFM-A13 is a potent inhibitor of Jak2 kinase activity.
Bujor AM, Haines P, Padilla C, Christmann RB, Junie M, Sampaio-Barros PD, Lafyatis R, Trojanowska M
International journal of molecular medicine 2012 Dec;30(6):1473-80
International journal of molecular medicine 2012 Dec;30(6):1473-80
FLI-1 functionally interacts with PIASxalpha, a member of the PIAS E3 SUMO ligase family.
van den Akker E, Ano S, Shih HM, Wang LC, Pironin M, Palvimo JJ, Kotaja N, Kirsh O, Dejean A, Ghysdael J
The Journal of biological chemistry 2005 Nov 11;280(45):38035-46
The Journal of biological chemistry 2005 Nov 11;280(45):38035-46
The Btk inhibitor LFM-A13 is a potent inhibitor of Jak2 kinase activity.
van den Akker E, van Dijk TB, Schmidt U, Felida L, Beug H, Löwenberg B, von Lindern M
Biological chemistry 2004 May;385(5):409-13
Biological chemistry 2004 May;385(5):409-13
No comments: Submit comment
No validations: Submit validation data