Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404993 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHRFAM7A antibody: synthetic peptide directed towards the middle region of human CHRFAM7A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGV
HCVPT PDSGVVCGRM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sensory gating and alpha-7 nicotinic receptor gene allelic variants in schizoaffective disorder, bipolar type.
Martin LF, Leonard S, Hall MH, Tregellas JR, Freedman R, Olincy A
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2007 Jul 5;144B(5):611-4
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2007 Jul 5;144B(5):611-4
No comments: Submit comment
No validations: Submit validation data