HPA001919

SH2D4A antibody from Sigma-Aldrich
FLJ20967, PPP1R38, SH2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001919, RRID:AB_1079947
Product name
Anti-SH2D4A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001919
Antibody type
Polyclonal
Antigen
SH2 domain-containing protein 4A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELL
LSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLI
DASADAYSFLGVDQLQHATLADLVEYHKEEPITSL
GKELLLYPCGQQ
Storage
-20C
Provider Type Product Number
- No reagents -