Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108467 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NK2 Homeobox 8 (NKX2-8) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NKX2-8 antibody: synthetic peptide directed towards the C terminal of human NKX2-8.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
GTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFP
AYQHLASPALVSWNW- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Regulation of alpha-fetoprotein expression by Nkx2.8.
Kajiyama Y, Tian J, Locker J
Molecular and cellular biology 2002 Sep;22(17):6122-30
Molecular and cellular biology 2002 Sep;22(17):6122-30
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Hum. Adult Placenta; Host: Rabbit . Target Name: NKX2-8 . Sample Tissue: Human Adult Placenta . Antibody Dilution: 1.0ug/ml.; NKX2-8 antibody - C-terminal region (AP42061PU-N) in Hum. Adult Placenta cells using Western Blot