Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183136 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cullin 5 (CUL5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CUL5 antibody: synthetic peptide directed towards the C terminal of human CUL5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEE
FYKKN HSGRKLHWHH- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references T47D breast cancer cell growth is inhibited by expression of VACM-1, a cul-5 gene.
Burnatowska-Hledin MA, Kossoris JB, Van Dort CJ, Shearer RL, Zhao P, Murrey DA, Abbott JL, Kan CE, Barney CC
Biochemical and biophysical research communications 2004 Jul 2;319(3):817-25
Biochemical and biophysical research communications 2004 Jul 2;319(3):817-25
No comments: Submit comment
No validations: Submit validation data