ABIN504624

RPH3A antibody from antibodies-online
exophilin-1, KIAA0985, rabphilin

Antibody data

Product number
ABIN504624
Provider
antibodies-online
Product name
anti-Rabphilin 3A Homolog (Mouse) (RPH3A) (N-Term) antibody
Provider product page
antibodies-online - ABIN504624
Antibody type
Polyclonal
Antigen
The immunogen for anti-RPH3A antibody: synthetic peptide directed towards the N terminal of human RPH3A
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQ
ERIGR LVDRLENMRK
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -