Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504624 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Rabphilin 3A Homolog (Mouse) (RPH3A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPH3A antibody: synthetic peptide directed towards the N terminal of human RPH3A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQ
ERIGR LVDRLENMRK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Clinical significance of a novel single nucleotide polymorphism in the 5' untranslated region of the Rabphillin-3A-Like gene in colorectal adenocarcinoma.
Katkoori VR, Jia X, Chatla C, Kumar S, Ponnazhagan S, Callens T, Messiaen L, Grizzle WE, Manne U
Frontiers in bioscience : a journal and virtual library 2008 Jan 1;13:1050-61
Frontiers in bioscience : a journal and virtual library 2008 Jan 1;13:1050-61
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting