Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003662-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003662-M04, RRID:AB_565879
- Product name
- IRF4 monoclonal antibody (M04), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRF4.
- Antigen sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGR
SLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLAR
QLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRH
SSIQE- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IRF4 expression in transfected 293T cell line by IRF4 monoclonal antibody (M04), clone 3A10.Lane 1: IRF4 transfected lysate(51.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IRF4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol