Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000203-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000203-M06, RRID:AB_463986
- Product name
- AK1 monoclonal antibody (M06), clone 3A6-1F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AK1.
- Antigen sequence
MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYT
HLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE
TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEF
ERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD
DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNA
EGSVDSVFSQVCTHLDALK- Isotype
- IgG
- Antibody clone number
- 3A6-1F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AK1 monoclonal antibody (M06), clone 3A6-1F5 Western Blot analysis of AK1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 monoclonal antibody (M06), clone 3A6-1F5.Lane 1: AK1 transfected lysate(21.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of AK1 transfected lysate using anti-AK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AK1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol