Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009943-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009943-M06, RRID:AB_1016862
- Product name
- OXSR1 monoclonal antibody (M06), clone 1C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OXSR1.
- Antigen sequence
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVP
EQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDI- Isotype
- IgG
- Antibody clone number
- 1C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ASK3 responds to osmotic stress and regulates blood pressure by suppressing WNK1-SPAK/OSR1 signaling in the kidney.
Naguro I, Umeda T, Kobayashi Y, Maruyama J, Hattori K, Shimizu Y, Kataoka K, Kim-Mitsuyama S, Uchida S, Vandewalle A, Noguchi T, Nishitoh H, Matsuzawa A, Takeda K, Ichijo H
Nature communications 2012;3:1285
Nature communications 2012;3:1285
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- OXSR1 monoclonal antibody (M06), clone 1C8 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to OXSR1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol