Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009064-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009064-A01, RRID:AB_606554
- Product name
- MAP3K6 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant MAP3K6.
- Antigen sequence
HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVL
LPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFP
VASICGVSASKRDERCCFLYALPPAQDVQLC- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dual engagement of 14-3-3 proteins controls signal relay from ASK2 to the ASK1 signalosome.
Mitogen-activated protein 3 kinase 6 mediates angiogenic and tumorigenic effects via vascular endothelial growth factor expression.
Cockrell LM, Puckett MC, Goldman EH, Khuri FR, Fu H
Oncogene 2010 Feb 11;29(6):822-30
Oncogene 2010 Feb 11;29(6):822-30
Mitogen-activated protein 3 kinase 6 mediates angiogenic and tumorigenic effects via vascular endothelial growth factor expression.
Eto N, Miyagishi M, Inagi R, Fujita T, Nangaku M
The American journal of pathology 2009 Apr;174(4):1553-63
The American journal of pathology 2009 Apr;174(4):1553-63
No comments: Submit comment
No validations: Submit validation data