Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010715-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010715-A01, RRID:AB_502988
- Product name
- LASS1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LASS1.
- Antigen sequence
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSK
AEKPLRNGLVKDKRF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells.
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
CLN5 and CLN8 protein association with ceramide synthase: biochemical and proteomic approaches.
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI
Anticancer research 2012 Mar;32(3):753-60
Anticancer research 2012 Mar;32(3):753-60
siRNA-mediated down-regulation of ceramide synthase 1 leads to apoptotic resistance in human head and neck squamous carcinoma cells after photodynamic therapy.
Separovic D, Breen P, Joseph N, Bielawski J, Pierce JS, VAN Buren E, Gudz TI
Anticancer research 2012 Jul;32(7):2479-85
Anticancer research 2012 Jul;32(7):2479-85
CLN5 and CLN8 protein association with ceramide synthase: biochemical and proteomic approaches.
Haddad SE, Khoury M, Daoud M, Kantar R, Harati H, Mousallem T, Alzate O, Meyer B, Boustany RM
Electrophoresis 2012 Dec;33(24):3798-809
Electrophoresis 2012 Dec;33(24):3798-809
Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jan;24(1):296-308
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2010 Jan;24(1):296-308
Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas.
Senkal CE, Ponnusamy S, Rossi MJ, Bialewski J, Sinha D, Jiang JC, Jazwinski SM, Hannun YA, Ogretmen B
Molecular cancer therapeutics 2007 Feb;6(2):712-22
Molecular cancer therapeutics 2007 Feb;6(2):712-22
No comments: Submit comment
No validations: Submit validation data