Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003954-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003954-A01, RRID:AB_714758
- Product name
- LETM1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LETM1.
- Antigen sequence
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKL
APANGMPTGENVISVAELINAMKQVKHIPESKLTS
LAAALDENKDGKVNIDDLVKVIELVDKEDVHISTS
QVA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Mallilankaraman K, Cárdenas C, Doonan PJ, Chandramoorthy HC, Irrinki KM, Golenár T, Csordás G, Madireddi P, Yang J, Müller M, Miller R, Kolesar JE, Molgó J, Kaufman B, Hajnóczky G, Foskett JK, Madesh M
Nature cell biology 2012 Dec;14(12):1336-43
Nature cell biology 2012 Dec;14(12):1336-43
No comments: Submit comment
No validations: Submit validation data