Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008767-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008767-M01, RRID:AB_714842
- Product name
- RIPK2 monoclonal antibody (M01), clone 2C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RIPK2.
- Antigen sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLS
RDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEE
FAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLL
QNKSM- Isotype
- IgG
- Antibody clone number
- 2C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M01), clone 2C7.Lane 1: RIPK2 transfected lysate(61.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RIPK2 monoclonal antibody (M01), clone 2C7. Western Blot analysis of RIPK2 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RIPK2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol