Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054101-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054101-M02, RRID:AB_804904
- Product name
- RIPK4 monoclonal antibody (M02), clone 1G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RIPK4.
- Antigen sequence
HLAARNGHLATVKLLVEEKADVLARGPLNQTALHL
AAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQ
GRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLL
RRSKT- Isotype
- IgG
- Antibody clone number
- 1G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RIPK4 monoclonal antibody (M02), clone 1G2 Western Blot analysis of RIPK4 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RIPK4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol