Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001956-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001956-M02, RRID:AB_875551
- Product name
- EGFR monoclonal antibody (M02), clone 4H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EGFR.
- Antigen sequence
EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNT
VERIPLENLQIIRGNMYYENSYALAVLSNY- Isotype
- IgG
- Antibody clone number
- 4H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references On-substrate fabrication of a bio-conjugated Au nanoring solution for photothermal therapy application.
Tseng HY, Chen WF, Chu CK, Chang WY, Kuo Y, Kiang YW, Yang CC
Nanotechnology 2013 Feb 15;24(6):065102
Nanotechnology 2013 Feb 15;24(6):065102
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EGFR is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol