Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003035-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003035-M03, RRID:AB_1111883
- Product name
- HARS monoclonal antibody (M03), clone 4D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HARS.
- Antigen sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEV
AKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQM
AVREKVFDVIIRCFKRHGAEVIDTPV- Isotype
- IgG
- Antibody clone number
- 4D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in IMR-32.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HARS is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HARS is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol