Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000052-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000052-M06, RRID:AB_1111651
- Product name
- ACP1 monoclonal antibody (M06), clone 2A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant ACP1.
- Antigen sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQN
ISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIH
TAHKARQITKEDFATFDYILCMDESNLRDLNRKSN
QVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE
TVYQQCVRCCRAFLEKAH- Isotype
- IgG
- Antibody clone number
- 2A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M06), clone 2A3.Lane 1: ACP1 transfected lysate(18 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACP1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol