H00003091-M02
antibody from Abnova Corporation
Targeting: HIF1A
bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003091-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003091-M02, RRID:AB_1111887
- Product name
- HIF1A monoclonal antibody (M02), clone 1D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIF1A.
- Antigen sequence
QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLS
WKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQS
MDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRA
LDQVN- Isotype
- IgG
- Antibody clone number
- 1D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HIF1A is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HDAC2 and HIF1A. HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal 1:1200 and anti-HIF1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)