Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006788-M13 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006788-M13, RRID:AB_1137478
- Product name
- STK3 monoclonal antibody (M13), clone 4F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STK3.
- Antigen sequence
EEEENSDEDELDSHTMVKTSVESVGTMRATSTMSE
GAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMK
RNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMH
EPFPMSKNVFPDNWKV- Isotype
- IgG
- Antibody clone number
- 4F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STK3 expression in transfected 293T cell line by STK3 monoclonal antibody (M13), clone 4F7.Lane 1: STK3 transfected lysate(56.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK3 monoclonal antibody (M13), clone 4F7. Western Blot analysis of STK3 expression in HepG2(Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STK3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol