H00029760-M04
antibody from Abnova Corporation
Targeting: BLNK
BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029760-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029760-M04, RRID:AB_1571663
- Product name
- BLNK monoclonal antibody (M04), clone 1D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BLNK.
- Antigen sequence
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTIS
EQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFL
IRKSSGHDSKQPYTLVVFFNKRVYNIPVRF- Isotype
- IgG
- Antibody clone number
- 1D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BLNK monoclonal antibody (M04), clone 1D7. Western Blot analysis of BLNK expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between NCK1 and BLNK. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-BLNK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)