H00007852-M02
antibody from Abnova Corporation
Targeting: CXCR4
CD184, D2S201E, fusin, HM89, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007852-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007852-M02, RRID:AB_1237684
- Product name
- CXCR4 monoclonal antibody (M02), clone 1F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CXCR4.
- Antigen sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENAN
FNKIFLPTIYS- Isotype
- IgG
- Antibody clone number
- 1F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Negative regulation of chemokine receptor signaling and B-cell chemotaxis by p66Shc.
Patrussi L, Capitani N, Cannizzaro E, Finetti F, Lucherini OM, Pelicci PG, Baldari CT
Cell death & disease 2014 Feb 20;5:e1068
Cell death & disease 2014 Feb 20;5:e1068
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CXCR4 monoclonal antibody (M02), clone 1F8. Western Blot analysis of CXCR4 expression in human Intestinal wall.