Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001208-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001208-D01P, RRID:AB_1573077
- Product name
- CLPS purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CLPS protein.
- Antigen sequence
MEKILILLLVALSVAYAAPGPRGIIINLENGELCM
NSAQCKSNCCQHSSALGLARCTSMASENSECSVKT
LYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICH
DAGRSKQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CLPS expression in transfected 293T cell line (H00001208-T01) by CLPS MaxPab polyclonal antibody.Lane 1: CLPS transfected lysate(12.00 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CLPS MaxPab rabbit polyclonal antibody. Western Blot analysis of CLPS expression in human pancreas.