Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005970-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005970-M01A, RRID:AB_1579676
- Product name
- RELA monoclonal antibody (M01A), clone 8G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RELA.
- Antigen sequence
GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDL
ASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAIT
RLVT- Isotype
- IgG
- Antibody clone number
- 8G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RELA monoclonal antibody (M01A), clone 8G3 Western Blot analysis of RELA expression in Hela S3 NE ( Cat # L013V3 ).