Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00143471-M03A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00143471-M03A, RRID:AB_1712036
- Product name
- PSMA8 monoclonal antibody (M03A), clone 2E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PSMA8.
- Antigen sequence
GFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVR
EFLEKNYTEDAIASDSEAIKLAIKALLEVVQSGGR
NIELAIIRRNQPLKMFSAKEVELYVTEIEK- Isotype
- IgG
- Antibody clone number
- 2E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMA8 monoclonal antibody (M03A), clone 2E3 Western Blot analysis of PSMA8 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMA8 monoclonal antibody (M03A), clone 2E3. Western Blot analysis of PSMA8 expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMA8 monoclonal antibody (M03A), clone 2E3. Western Blot analysis of PSMA8 expression in Jurkat ( Cat # L017V1 ).