Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000573-M02A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000573-M02A, RRID:AB_10628560
- Product name
- BAG1 monoclonal antibody (M02A), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BAG1.
- Antigen sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLD
RRVKATIEQFMKILEEIDTLILPENFKDSRLKRKG
LVKKVQAFLAECDTVEQNICQETERLQSTNFALAE- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02A), clone 2D3. Western Blot analysis of BAG1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02A), clone 2D3. Western Blot analysis of BAG1 expression in LNCaP ( Cat # L004V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BAG1 monoclonal antibody (M02A), clone 2D3 Western Blot analysis of BAG1 expression in HeLa ( Cat # L013V1 ).